{"product_id":"proteintech-27809-1-ap","title":"Proteintech, 27809-1-AP, pan-AKT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe pan-AKT (27809-1-AP) by Proteintech is a Polyclonal antibody targeting pan-AKT in WB, ELISA applications with reactivity to human, mouse samples\n27809-1-AP targets pan-AKT in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NIH\/3T3 cells,  HEK-293 cells,  HeLa cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKT (also known as protein kinase B, PKB) is a serine threonine protein kinase consisting of three isoforms, AKT1, AKT2, and AKT3, which are encoded by three distinct genes, PKBα, PKBβ, and PKBγ, respectively. Among them, AKT1 is ubiquitously expressed and primarily regulates cell survival, AKT2 controls glucose metabolism, while AKT3 is highly expressed in the brain and testes. These isoforms are central nodes in the PI3K-AKT-mTOR signaling pathway, which is a critical regulator of cell survival, growth, proliferation, and metabolism (PMID: 25811375, PMID: 31173856, PMID: 36180910). This antibody detects total AKT1, AKT2, and AKT3 isoforms, typically showing a molecular weight of approximately 56-62 kDa in Western blot analysis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26642 Product name: Recombinant human AKT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 293-405 aa of BC000479 Sequence: FGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQH Predict reactive species\nFull Name: v-akt murine thymoma viral oncogene homolog 1\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 56-62 kDa\nGenBank Accession Number: BC000479\nGene Symbol: AKT1\nGene ID (NCBI): 207\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31749\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887750303913,"sku":"27809-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27809-1-ap","provider":"Iright","version":"1.0","type":"link"}