{"product_id":"proteintech-27836-1-ap","title":"Proteintech, 27836-1-AP, SEMA3A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEMA3A (27836-1-AP) by Proteintech is a Polyclonal antibody targeting SEMA3A in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n27836-1-AP targets SEMA3A in WB, IF\/ICC, CoIP, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, SH-SY5Y cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEMA3A (Semaphorin 3A), a class-3 semaphorin signaling protein, is involved in cell signaling with PlexinA1 and Neuropilin-1 (NRP1) receptors and it is responsible for recruiting dendritic cells into lymphatics. It's widely expressed in different tissues (PMID:10766232). SEMA3A has been shown to exert osteoprotective effects, characterized by increasing bone formation while inhibiting the activation of osteoclast precursor cells (PMID:36598593). However, SEMA3A also modulates the immune system. SEMA3A expression in a myocardial infarct area enhances macrophage polarization and inhibits monocyte migration into the lesion area (PMID:28540528).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27173 Product name: Recombinant human SEMA3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-235 aa of BC111416 Sequence: ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES Predict reactive species\nFull Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A\nCalculated Molecular Weight: 771 aa, 89 kDa\nObserved Molecular Weight: 89 and 65 kDa\nGenBank Accession Number: BC111416\nGene Symbol: SEMA3A\nGene ID (NCBI): 10371\nRRID: AB_2880989\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14563\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869010120873,"sku":"27836-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27836-1-ap","provider":"Iright","version":"1.0","type":"link"}