{"product_id":"proteintech-27856-1-ap","title":"Proteintech, 27856-1-AP, YME1L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YME1L1 (27856-1-AP) by Proteintech is a Polyclonal antibody targeting YME1L1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n27856-1-AP targets YME1L1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  MCF-7 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYME1L1(ATP-dependent zinc metalloprotease) is also named as FTSH1, YME1L,Meg-4,PAMP. YME1L1 plays a phylogenetically conserved role in mitochondrial protein metabolism.It also ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity and protects mitochondria from the accumulation of oxidatively damaged membrane proteins. YME1L1 can prevent mitochondrial DNA inserting into nuclear. It has 3 isoforms produced by alternative splicing with the molecular weight of 86 kDa, 80 kDa and 76 kDa. This protein can migrate with a molecular weight of about 55-63 kDa, which is the size of the mature YME1L1 protein(PMID:22252130; 22354088).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27280 Product name: Recombinant human YME1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-239 aa of BC023507 Sequence: QNQHRDVVPEHEAPSSEPSLNLRDLGLSELKIGQIDQLVENLLPGFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSCLYRHHSRALQSICSDLQYWPVFIQSRGFKTLKSRTRRLQSTSERLAETQNIAPSFVKGFLLRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLI Predict reactive species\nFull Name: YME1-like 1 (S. cerevisiae)\nCalculated Molecular Weight: 716 aa, 80 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC023507\nGene Symbol: YME1L1\nGene ID (NCBI): 10730\nRRID: AB_3085999\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96TA2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887926300841,"sku":"27856-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27856-1-ap","provider":"Iright","version":"1.0","type":"link"}