{"product_id":"proteintech-27872-1-ap","title":"Proteintech, 27872-1-AP, Gamma Catenin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Gamma Catenin (27872-1-AP) by Proteintech is a Polyclonal antibody targeting Gamma Catenin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n27872-1-AP targets Gamma Catenin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, HUVEC cells,  T-47D cells,  mouse heart tissue,  MCF-7 cells,  rat heart tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, HeLa cells,  A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27394 Product name: Recombinant human JUP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 669-745 aa of BC000441 Sequence: TNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA Predict reactive species\nFull Name: junction plakoglobin\nObserved Molecular Weight: 82 kDa\nGenBank Accession Number: BC000441\nGene Symbol: Gamma Catenin\nGene ID (NCBI): 3728\nRRID: AB_2881000\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14923\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869462417577,"sku":"27872-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27872-1-ap","provider":"Iright","version":"1.0","type":"link"}