{"product_id":"proteintech-27873-1-ap","title":"Proteintech, 27873-1-AP, CD83 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD83 (27873-1-AP) by Proteintech is a Polyclonal antibody targeting CD83 in WB, IHC, ELISA applications with reactivity to human samples\n27873-1-AP targets CD83 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, Daudi cells,  PNGF treated Daudi cells,  PNGF treated Raji cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928). PNGase F (peptide N-glycosidase F) digestion reduced the 37 and 50 kDa CD83 forms to 28 kDa (PMID: 15320871).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27467 Product name: Recombinant human CD83 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-144 aa of BC030830 Sequence: EVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE Predict reactive species\nFull Name: CD83 molecule\nCalculated Molecular Weight: 205 aa, 23 kDa\nObserved Molecular Weight: 37-50kDa, 23kDa\nGenBank Accession Number: BC030830\nGene Symbol: CD83\nGene ID (NCBI): 9308\nENSEMBL Gene ID: ENSG00000112149\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01151\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886329745577,"sku":"27873-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27873-1-ap","provider":"Iright","version":"1.0","type":"link"}