{"product_id":"proteintech-27875-1-ap","title":"Proteintech, 27875-1-AP, EGLN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EGLN3 (27875-1-AP) by Proteintech is a Polyclonal antibody targeting EGLN3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27875-1-AP targets EGLN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEGLN3, also named as HPH-1, HIF-PH3, HPH-3 and PHD3, is a cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. It is a regulator of cardiomyocyte and neuronal apoptosis. EGLN3 can be a prognostic marker for gastric cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27464 Product name: Recombinant human EGLN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC010992 Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK Predict reactive species\nFull Name: egl nine homolog 3 (C. elegans)\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC010992\nGene Symbol: EGLN3\nGene ID (NCBI): 112399\nRRID: AB_3086001\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6Z9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869533982889,"sku":"27875-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27875-1-ap","provider":"Iright","version":"1.0","type":"link"}