{"product_id":"proteintech-27882-1-ap","title":"Proteintech, 27882-1-AP, PCSK9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCSK9 (27882-1-AP) by Proteintech is a Polyclonal antibody targeting PCSK9 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n27882-1-AP targets PCSK9 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, rat liver tissue,  mouse liver tissue\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProprotein convertase subtilisin\/kexin type 9 (PCSK9) is a crucial protein governing the circulating levels of low density lipoprotein-cholesterol (LDL-C), by virtue of its pivotal role in the degradation of the LDL receptor (LDLR). PCSK9 is expressed in the kidney and lung. It is synthesized as a 72 kDa immature precursor that undergoes autocatalytic cleavage in the endoplasmic reticulum to generate a 63 kDa mature protein. The cleaved N-terminal fragment remains associated with the mature protein and is necessary for its secretion, allowing it to circulate in the blood. The ability of PCSK9 to regulate a diverse group of cell-surface proteins hinted that it might also be able to influence additional membrane proteins that are important in anti-tumour immune responses. Targeting PCSK9 to treat cancer is also attractive because two neutralizing antibodies against it, evolocumab and alirocumab, have already been approved for human clinical use to lower cholesterol levels. (PMID: 30522786, PMID: 22493497)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27254 Product name: Recombinant human PCSK9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-692 aa of NM_174936.3 Sequence: MRCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ Predict reactive species\nFull Name: proprotein convertase subtilisin\/kexin type 9\nCalculated Molecular Weight: 74 kDa\nObserved Molecular Weight: 72-78 kDa, 62 kDa\nGenBank Accession Number: NM_174936.3\nGene Symbol: PCSK9\nGene ID (NCBI): 255738\nRRID: AB_2918134\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NBP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868926496937,"sku":"27882-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27882-1-ap","provider":"Iright","version":"1.0","type":"link"}