{"product_id":"proteintech-27889-1-ap","title":"Proteintech, 27889-1-AP, NAP1L4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NAP1L4 (27889-1-AP) by Proteintech is a Polyclonal antibody targeting NAP1L4 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n27889-1-AP targets NAP1L4 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HuH-7 cells,  mouse heart tissue,  mouse testis tissue,  rat heart tissue,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNAP1L4 is a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27469 Product name: Recombinant human NAP1L4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-375 aa of BC022090 Sequence: TKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV Predict reactive species\nFull Name: nucleosome assembly protein 1-like 4\nCalculated Molecular Weight: 375 aa, 43 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC022090\nGene Symbol: NAP1L4\nGene ID (NCBI): 4676\nRRID: AB_2881006\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99733\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887731986601,"sku":"27889-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27889-1-ap","provider":"Iright","version":"1.0","type":"link"}