{"product_id":"proteintech-27935-1-ap","title":"Proteintech, 27935-1-AP, WNT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WNT1 (27935-1-AP) by Proteintech is a Polyclonal antibody targeting WNT1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n27935-1-AP targets WNT1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 3T3-L1 cells, HepG2 cells,  NIH\/3T3 cells,  Jurkat cells\nPositive IF\/ICC detected in: NIH\/3T3 cells, HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27380 Product name: Recombinant human WNT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 228-323 aa of BC074799 Sequence: TVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALD Predict reactive species\nFull Name: wingless-type MMTV integration site family, member 1\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC074799\nGene Symbol: WNT1\nGene ID (NCBI): 7471\nRRID: AB_2881013\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04628\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868840415401,"sku":"27935-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27935-1-ap","provider":"Iright","version":"1.0","type":"link"}