{"product_id":"proteintech-27953-1-ap","title":"Proteintech, 27953-1-AP, CDSN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDSN (27953-1-AP) by Proteintech is a Polyclonal antibody targeting CDSN in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27953-1-AP targets CDSN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue\nPositive IHC detected in: human brown diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27688 Product name: Recombinant human CDSN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC031993 Sequence: MGSSRAPWMGRVGGHGMMALLLAGLLLPGTLAKSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSG Predict reactive species\nFull Name: corneodesmosin\nCalculated Molecular Weight: 528 aa, 52 kDa\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC031993\nGene Symbol: CDSN\nGene ID (NCBI): 1041\nRRID: AB_2881022\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15517\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869655027881,"sku":"27953-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27953-1-ap","provider":"Iright","version":"1.0","type":"link"}