{"product_id":"proteintech-27977-1-ap","title":"Proteintech, 27977-1-AP, RHNO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHNO1 (27977-1-AP) by Proteintech is a Polyclonal antibody targeting RHNO1 in IP, ELISA applications with reactivity to human, mouse samples\n27977-1-AP targets RHNO1 in  applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRHNO1 (Rad9-Hus1-Rad1 Interacting Nuclear Orphan 1) is a protein associated with the DNA replication stress (DRS) response and DNA repair. It interacts with the 9-1-1 checkpoint clamp and TopBP1 to activate the ATR\/Chk1 signaling pathway, thereby maintaining genomic integrity. Additionally, RHNO1 has been identified as a key facilitator of theta-mediated end joining (TMEJ), a DNA repair mechanism related to cancer progression and chemotherapy resistance. In cancer research, RHNO1 is considered a potential therapeutic target due to its high expression in tumor cells and its regulatory role in cell proliferation and survival.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14789 Product name: Recombinant human C12orf32 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-241 aa of BC005106 Sequence: HRLMPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFPAYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNMSVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGKLSRSQFLVKS Predict reactive species\nFull Name: chromosome 12 open reading frame 32\nCalculated Molecular Weight: 238 aa, 27 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC005106\nGene Symbol: C12orf32\nGene ID (NCBI): 83695\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BSD3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887784480937,"sku":"27977-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27977-1-ap","provider":"Iright","version":"1.0","type":"link"}