{"product_id":"proteintech-27988-1-ap","title":"Proteintech, 27988-1-AP, TOX4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOX4 (27988-1-AP) by Proteintech is a Polyclonal antibody targeting TOX4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n27988-1-AP targets TOX4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, K-562 cells,  MCF-7 cells,  PC-3 cells,  Raji cells\nPositive IHC detected in: rat bladder tissue, mouse bladder tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOX (Thymocyte selection-associated HMG bOX) genes represent a novel gene family and encode a novel nuclear DNA binding protein belonging to a large superfamily of HMG (high mobility group)-box family. TOX proteins consist a small subfamily of proteins, including TOX1, TOX2, TOX3, and TOX4. The TOX subfamily members are highly conserved among vertebrates. \nTOX4 was recently found to be one of the subunits of the PP1C, which consists of three regulatory proteins, PNUTS, TOX4, and WDR82, and one of the PP1 phosphatases, PP1α, β, andγ25. Tox4 can modulate cell fate by reprogramming from a somatic state into a pluripotent and neuronal fate (PMID:31519808). Despite a predicted molecular mass of TOX4 protein of 66 kDa, the detection band of western blot analysis in many literatures is 100 kDa (PMID:37286708;35365735). This antibody was also detected at around 100 kda.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27638 Product name: Recombinant human TOX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-215 aa of BC013689 Sequence: SLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKR Predict reactive species\nFull Name: TOX high mobility group box family member 4\nCalculated Molecular Weight: 621 aa, 66 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC013689\nGene Symbol: TOX4\nGene ID (NCBI): 9878\nRRID: AB_3086019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94842\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869780037801,"sku":"27988-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27988-1-ap","provider":"Iright","version":"1.0","type":"link"}