{"product_id":"proteintech-27991-1-ap","title":"Proteintech, 27991-1-AP, KLKB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLKB1 (27991-1-AP) by Proteintech is a Polyclonal antibody targeting KLKB1 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n27991-1-AP targets KLKB1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse pancreas tissue,  rat kidney tissue,  rat pancreas tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman Plasma Kallikrein, a serine protease also named as KLKB1, KLK3, PPK or Kininogenin, is synthesized in the liver and circulates in the plasma by binding to high molecular weight (HMW) kininogen or as a free zymogen. It cleaves HMW kininogen, its major physiological substrate, to release the potent vasodilator peptide bradykinin. It is also able to cleave a number of inactive precursor proteins to generate active products, such as plasminogen and prourokinase. Thus, it plays an important role in blood pressure regulation, fibrinolysis, and neutrophil activation. KLKB1 precursor contains a signal peptide (residues 1 to 19) and a pro form sequence (residues 20 to 638). Upon activation, the pro form is converted to a heavy chain and a light chain, which is linked by disulfide bonds and the latter contains the catalytic domain (PMID: 3521732). KLKB1 is a ~70 kDa protein and can be detected as 80-86 kDa(glycosylation form), 52 kDa(heavy chain), 36-44kDa(light chain) and 18 kDa(often detected in cancer) (PMID: 17963278, 3521732). KLKB1 may be a potential candidate serum biomarker of cancer. The antigen of this antibody just cover the heavy chain of KLKB1, so this antibody cannot recognize the light chain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27491 Product name: Recombinant human KLKB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-348 aa of NM_000892 Sequence: MASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCF Predict reactive species\nFull Name: kallikrein B, plasma (Fletcher factor) 1\nCalculated Molecular Weight: 71 kDa\nObserved Molecular Weight: 52-70 kDa\nGenBank Accession Number: NM_000892\nGene Symbol: KLKB1\nGene ID (NCBI): 3818\nRRID: AB_2881032\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P03952\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887698792617,"sku":"27991-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27991-1-ap","provider":"Iright","version":"1.0","type":"link"}