{"product_id":"proteintech-28028-1-ap","title":"Proteintech, 28028-1-AP, PLSCR3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLSCR3 (28028-1-AP) by Proteintech is a Polyclonal antibody targeting PLSCR3 in WB, IHC, ELISA applications with reactivity to Human, Mouse, rat samples\n28028-1-AP targets PLSCR3 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, A431 cells,  mouse liver tissue,  mouse lung tissue,  rat kidney tissue,  rat liver tissue,  rat lung tissue,  BxPC-3 cells\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLSCR3, also named as PLS3, belongs to the phospholipid scramblase family. It may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. PLSCR3 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. It is a target of protein kinase C-δ (PKC-δ), resides in mitochondria and plays pivotal roles in regulating apoptotic response. Phosphorylation of PLSCR3 by PKC-δ is involved in the hyperthermia-induced apoptotic signal transduction pathway in Tca8113 cells, and that Hsp27 blocks this pathway to suppress hyperthermia-induced apoptosis. (PMID:20569108)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27655 Product name: Recombinant human PLSCR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC011735 Sequence: MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS Predict reactive species\nFull Name: phospholipid scramblase 3\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC011735\nGene Symbol: PLSCR3\nGene ID (NCBI): 57048\nRRID: AB_2881040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRY6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869488238761,"sku":"28028-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28028-1-ap","provider":"Iright","version":"1.0","type":"link"}