{"product_id":"proteintech-28031-1-ap","title":"Proteintech, 28031-1-AP, TMEM184B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM184B (28031-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM184B in IHC, ELISA applications with reactivity to Human samples\n28031-1-AP targets TMEM184B in IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransmembrane protein 184B (TMEM184B) is a seven-pass transmembrane protein highly expressed in the nervous system and is thought to play a role in neuronal excitability, synaptic structure, and expression of key developmental and adult pathways involved in neuronal differentiation (PMID: 27122027; 37730546). TMEM184B may activate the MAP kinase signaling pathway (PMID: 12761501). TMEM184B has also been reported to be necessary for interleukin-31-induced itch, promoting adult somatosensation through developmental Wnt signaling and promotion of proper pruriceptive gene expression (PMID: 34629389).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27704 Product name: Recombinant human TMEM184B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 318-407 aa of BC015489 Sequence: VYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF Predict reactive species\nFull Name: transmembrane protein 184B\nGenBank Accession Number: BC015489\nGene Symbol: TMEM184B\nGene ID (NCBI): 25829\nRRID: AB_3086023\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y519\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887831175337,"sku":"28031-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28031-1-ap","provider":"Iright","version":"1.0","type":"link"}