{"product_id":"proteintech-28037-1-ap","title":"Proteintech, 28037-1-AP, CLK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLK3 (28037-1-AP) by Proteintech is a Polyclonal antibody targeting CLK3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n28037-1-AP targets CLK3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MCF-7 cells,  mouse testis tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLK3 (CDC Like Kinase 3) encodes a protein belonging to the serine\/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that functions on substrates containing serine\/threonine and tyrosine. CLK3 modulates RNA splicing by phosphorylating serine\/arginine-rich proteins such as SRSF1 and SRSF3. CLK3 dysregulation was indicated to be a high-penetrant factor in different types of human tumors even though its functions in tumors were not clearly characterized (PMID: 32453420). CLK3 has 4 isoforms, which is 74kDa, 59kDa, 56kDa and 18kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27741 Product name: Recombinant human CLK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC002555 Sequence: MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASS Predict reactive species\nFull Name: CDC-like kinase 3\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC002555\nGene Symbol: CLK3\nGene ID (NCBI): 1198\nRRID: AB_3669638\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49761\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886621708457,"sku":"28037-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28037-1-ap","provider":"Iright","version":"1.0","type":"link"}