{"product_id":"proteintech-28074-1-ap","title":"Proteintech, 28074-1-AP, Ki-67 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ki-67 (28074-1-AP) by Proteintech is a Polyclonal antibody targeting Ki-67 in IHC, IF\/ICC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to mouse samples\n28074-1-AP targets Ki-67 in WB, IHC, IF\/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse colon tissue, mouse spleen tissue\nPositive IF-Fro detected in: mouse spleen tissue, mouse liver tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:1500-1:6000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27894 Product name: Recombinant mouse ki67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2777-3005 aa of NM_001081117 Sequence: MFQSSPRRPRTRRGKVEADEEPSAVRKTVSTSRQTMRSRKVPEIGNNGTQVSKASIKQTLDTVAKVTGSRRQLRTHKDGVQPLEVLGDSKEITQISDHSEKLAHDTSILKSTQQQKPDSVKPLRTCRRVLRASKEDPKEVLVDTRDHATLQSKSNPLLSPKRKSARDGSIVRTRALRSLAPKQEATDEKPVPEKKRAASSKRHVSPEPVKMKHLKIVSNKLESVEEQVST Predict reactive species\nFull Name: antigen identified by monoclonal antibody Ki 67\nCalculated Molecular Weight: 351 kDa\nGenBank Accession Number: NM_001081117\nGene Symbol: ki67\nGene ID (NCBI): 17345\nRRID: AB_2918145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: E9PVX6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868824653993,"sku":"28074-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28074-1-ap","provider":"Iright","version":"1.0","type":"link"}