{"product_id":"proteintech-28085-1-ap","title":"Proteintech, 28085-1-AP, NPC1L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPC1L1 (28085-1-AP) by Proteintech is a Polyclonal antibody targeting NPC1L1 in WB, IHC, ELISA applications with reactivity to Human samples\n28085-1-AP targets NPC1L1 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPC1 like intracellular cholesterol transporter 1 (NPC1L1) is a multi-pass membrane protein which has 1332 amino acids and containing a conserved N-terminal Niemann-Pick C1 (NPC1) domain and a putative sterol-sensing domain (SSD). It is only found in the tubular membranes of primate hepatocytes and the brush-border membranes of the small intestine of mammals. PC1L1 is a key protein for intestinal absorption of cholesterol and plays an important role in cholesterol balance. Cholesterol contributes to cell proliferation, invasion and latency, and is essential for tumor formation and growth, so NPC1L1 plays a critical role in tumor development and spread (PMID: 36034854).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26277 Product name: Recombinant human NPC1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 415-514 aa of NM_001101648 Sequence: MPNRSSYRYDSLLLGPKNFSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTS Predict reactive species\nFull Name: NPC1 (Niemann-Pick disease, type C1, gene)-like 1\nCalculated Molecular Weight: 149 kDa\nObserved Molecular Weight: 140-149 kDa\nGenBank Accession Number: NM_001101648\nGene Symbol: NPC1L1\nGene ID (NCBI): 29881\nRRID: AB_2918146\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHC9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869477195945,"sku":"28085-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28085-1-ap","provider":"Iright","version":"1.0","type":"link"}