{"product_id":"proteintech-28089-1-ap","title":"Proteintech, 28089-1-AP, RSAD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RSAD2 (28089-1-AP) by Proteintech is a Polyclonal antibody targeting RSAD2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n28089-1-AP targets RSAD2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, A549 cells,  mouse spinal cord tissue\nPositive IHC detected in: mouse stomach tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27733 Product name: Recombinant human RSAD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 181-361 aa of BC017969 Sequence: DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Predict reactive species\nFull Name: radical S-adenosyl methionine domain containing 2\nCalculated Molecular Weight: 361 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC017969\nGene Symbol: RSAD2\nGene ID (NCBI): 91543\nRRID: AB_2881057\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WXG1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877443241,"sku":"28089-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28089-1-ap","provider":"Iright","version":"1.0","type":"link"}