{"product_id":"proteintech-28091-1-ap","title":"Proteintech, 28091-1-AP, NRSN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRSN1 (28091-1-AP) by Proteintech is a Polyclonal antibody targeting NRSN1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n28091-1-AP targets NRSN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNRSN1, also named as VMP and Neuro-p24, is a vesicular membrane protein with MW 24 kDa. It is a unique membranous protein that has a microtubule-binding domain and is specifically expressed in neurons. NRSN1 plays an active role in axonal regeneration as well as in embryonic development and neurite extension.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25972 Product name: Recombinant human NRSN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 90-195 aa of BC023514 Sequence: IEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT Predict reactive species\nFull Name: neurensin 1\nCalculated Molecular Weight: 195 aa, 21 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC023514\nGene Symbol: NRSN1\nGene ID (NCBI): 140767\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZ57\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887742603433,"sku":"28091-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28091-1-ap","provider":"Iright","version":"1.0","type":"link"}