{"product_id":"proteintech-28094-1-ap","title":"Proteintech, 28094-1-AP, DRD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DRD4 (28094-1-AP) by Proteintech is a Polyclonal antibody targeting DRD4 in WB, ELISA applications with reactivity to Human, Pig, mouse samples\n28094-1-AP targets DRD4 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Pig, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, pig brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe family of dopamine receptors (DRs) includes five G protein-coupled receptors (GPCRs)-DRD1, DRD2, DRD3, DRD4 and DRD5-with different anatomical distribution, expression levels, dopamine affinity, signal transduction, and effector targets (PMID:36523297). DRD4 (dopamine receptor D4) influences the postsynaptic action of dopamine and is implicated in many neurological processes, exhibits polymorphism and is one of the most studied genes in connection with psychiatric disorders (PMID:21873960). Moreover, DRD4 modulate glucose metabolism, and protect neurocytes from anoxia\/reoxygenation (A\/R) injury. Thus, DRD4 might regulate myocardial I\/R injury in association with GLUT4-mediated glucose metabolism (PMID:33584304).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Pig, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26930 Product name: Recombinant human DRD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-320 aa of NM_000797 Sequence: MRWEVARRAKLHGRAPRRPSGPGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRG Predict reactive species\nFull Name: dopamine receptor D4\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 40-44 kDa\nGenBank Accession Number: NM_000797\nGene Symbol: DRD4\nGene ID (NCBI): 1815\nRRID: AB_2881058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21917\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869532704937,"sku":"28094-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28094-1-ap","provider":"Iright","version":"1.0","type":"link"}