{"product_id":"proteintech-28101-1-ap","title":"Proteintech, 28101-1-AP, DMRTC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DMRTC2 (28101-1-AP) by Proteintech is a Polyclonal antibody targeting DMRTC2 in WB, ELISA applications with reactivity to human samples\n28101-1-AP targets DMRTC2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDouble sex and mab-3-related transcription factors (DMRT) like family C2 (DMRTC2), a member of the DMRT family genes, is involved in the regulation of mammalian sex differentiation and the process of spermatogenesis, particularly meiosis (PMID: 32244802). DMRTC2 is expressed in the testis and pancreas. DMRTC2 has 2 isoforms with the molecular mass of 24 and 39 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27355 Product name: Recombinant human DMRTC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC039266 Sequence: MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENI Predict reactive species\nFull Name: DMRT-like family C2\nCalculated Molecular Weight: 367 aa, 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC039266\nGene Symbol: DMRTC2\nGene ID (NCBI): 63946\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IXT2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887234830505,"sku":"28101-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28101-1-ap","provider":"Iright","version":"1.0","type":"link"}