{"product_id":"proteintech-28102-1-ap","title":"Proteintech, 28102-1-AP, SLC38A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC38A5 (28102-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A5 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n28102-1-AP targets SLC38A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27881 Product name: Recombinant human SLC38A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-48 aa of BC019246 Sequence: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKT Predict reactive species\nFull Name: solute carrier family 38, member 5\nCalculated Molecular Weight: 472 aa, 51 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC019246\nGene Symbol: SLC38A5\nGene ID (NCBI): 92745\nRRID: AB_2881061\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUX1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869602664617,"sku":"28102-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28102-1-ap","provider":"Iright","version":"1.0","type":"link"}