{"product_id":"proteintech-28106-1-ap","title":"Proteintech, 28106-1-AP, LIMD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIMD1 (28106-1-AP) by Proteintech is a Polyclonal antibody targeting LIMD1 in WB, IF\/ICC, IP, ELISA applications with reactivity to Human samples\n28106-1-AP targets LIMD1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIMD1 is a member of the Ajuba family of LIM domain-containing proteins, these kinds of proteins have been shown to play a role in intracellular signaling, transcriptional regulation and cellular differentiation, proliferation and migration (PMID:17174104). LIMD1 predominantly localizes to the cytoplasm especially in the E-cadherin cell-cell adhesive junction, yet also translocates to the nucleus when functions as an RB corepressor (PMID:19060205). And LIMD1 acts as a scaffolding protein to form a PHD-LIMD1-VHL axis, facilitating HIF1α ubiquitination and degradation by the proteasome (PMID:22800800). LIMD1 specifically interacts with retinoblastoma protein (pRB), inhibits E2F-mediated transcription, and suppresses the expression of the majority of genes with E2F1-responsive elements. As a tumor suppressor, LIMD1 blocks tumor growth in vitro and in vivo, and is frequently down-regulated in human lung tumors (PMID:15542589), and it also be detected in normal and breast cancer tissues.  \nLIMD1 protein exists several phosphorylation sites, which may affect its theoretical molecular weight when tested. Proteintech's 28106-1-AP antibody was generated by 133 amino acids, it could recognize the full-length protein in applications.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27974 Product name: Recombinant human LIMD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-260 aa of NM_014240 Sequence: MPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSIGLSVGSGWPSSPGSDPPLPKPCGDHPLNHRQLSLSSSRSSEGSLGGQNSGIGGRSSEKPT Predict reactive species\nFull Name: LIM domains containing 1\nCalculated Molecular Weight: 72 aa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: NM_014240\nGene Symbol: LIMD1\nGene ID (NCBI): 8994\nRRID: AB_2881062\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UGP4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869703229609,"sku":"28106-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28106-1-ap","provider":"Iright","version":"1.0","type":"link"}