{"product_id":"proteintech-28149-1-ap","title":"Proteintech, 28149-1-AP, DMRT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DMRT1 (28149-1-AP) by Proteintech is a Polyclonal antibody targeting DMRT1 in WB, IF-P, ELISA applications with reactivity to Human, mouse samples\n28149-1-AP targets DMRT1 in WB, IF-P, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, DU 145 cells,  LNCaP cells,  PC-3 cells,  SKOV-3 cells\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDMRT1, also named DMT1, belongs to the DMRT family. DMRT1 is one of the most conserved transcription factors in a variety of species and is involved in sex determination and germ cell differentiation. DMRT1 prevents the sexual switch from male to female, represses pluripotency, and balances mitosis versus meiosis. DMRT1 also maintains spermatogenesis and replenishes mGSCs by collaborating with Plzf and Sal-like protein 4 (PMID: 33420764). DMRT1 has 3 isoforms with the molecular mass of 18, 29, and 39 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28006 Product name: Recombinant human DMRT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-285 aa of BC040847 Sequence: VALRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMS Predict reactive species\nFull Name: doublesex and mab-3 related transcription factor 1\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC040847\nGene Symbol: DMRT1\nGene ID (NCBI): 1761\nRRID: AB_2935466\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5R6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887226278057,"sku":"28149-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28149-1-ap","provider":"Iright","version":"1.0","type":"link"}