{"product_id":"proteintech-28192-1-ap","title":"Proteintech, 28192-1-AP, WBSCR22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WBSCR22 (28192-1-AP) by Proteintech is a Polyclonal antibody targeting WBSCR22 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n28192-1-AP targets WBSCR22 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWBSCR22 (Williams-Beuren syndrome chromosomal region 22 protein), also known as BUD23, MERM1, is affected in Williams-Beuren syndrome and has been implicated in tumorigenesis and metastasis formation. WBSCR22 contains a nuclear localization signal and a common S-adenosyl-L-methionine binding motif that is evolutionarily conserved in methyltransferases (PMID: 29133897, 25525153). WBSCR22 protein is expressed at a high level in invasive breast cancer and its ectopic expression enhances tumor cell survival in the vasculature (PMID: 24086612).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28094 Product name: Recombinant human WBSCR22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC000169 Sequence: MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAKRL Predict reactive species\nFull Name: Williams Beuren syndrome chromosome region 22\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC000169\nGene Symbol: WBSCR22\nGene ID (NCBI): 114049\nRRID: AB_2918150\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43709\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869627469993,"sku":"28192-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28192-1-ap","provider":"Iright","version":"1.0","type":"link"}