{"product_id":"proteintech-28200-1-ap","title":"Proteintech, 28200-1-AP, IRAK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRAK2 (28200-1-AP) by Proteintech is a Polyclonal antibody targeting IRAK2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n28200-1-AP targets IRAK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse spleen tissue,  rat kidney tissue,  rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRAK2 (Interleukin-1 receptor-associated kinase 2) is a crucial protein involved in innate immune signaling and has diverse roles in various biological processes. IRAK2 belongs to the IRAK family of proteins, which share an N-terminal death domain (DD) that enables interactions with the DD-containing MyD88, and a central kinase domain (KD) (PMID: 24973222). IRAK2 has been implicated in various cancers. It is highly expressed in pancreatic cancer patients and is associated with poor prognosis. IRAK2 knockdown impairs pancreatic cancer cell proliferation (PMID: 37108068).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28179 Product name: Recombinant human IRAK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-251 aa of BC125184 Sequence: DDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIE Predict reactive species\nFull Name: interleukin-1 receptor-associated kinase 2\nCalculated Molecular Weight: 625 aa, 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC125184\nGene Symbol: IRAK2\nGene ID (NCBI): 3656\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43187\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887686439081,"sku":"28200-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28200-1-ap","provider":"Iright","version":"1.0","type":"link"}