{"product_id":"proteintech-28239-1-ap","title":"Proteintech, 28239-1-AP, CXCR5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCR5 (28239-1-AP) by Proteintech is a Polyclonal antibody targeting CXCR5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28239-1-AP targets CXCR5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  mouse spleen tissue,  rat spleen tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInitially discovered in 1992 as Burkitt's lymphoma receptor 1, CXCR5 (chemokine receptor 5, also known as CD185) is a seven-transmembrane G protein-coupled receptor (GPCR) protein (PMID: 32994482). CXCR5 is essential for naïve B-cell migration to and maturation in the lymph nodes and spleen, as well as for cluster of differentiation 4 T-cell (TFH and TCM) homing and interaction with B cells (PMID: 21471443). Moreover, CXCR5 is involved in the regulation of neural stem cells (NSC) and neuronal regeneration in the mouse brain, neuronal differentiation, neurogenesis, gliogenesis, and synaptogenesis (PMID: 37460877).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28271 Product name: Recombinant human CXCR5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 241-372 aa of NM_001716 Sequence: MVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF Predict reactive species\nFull Name: chemokine (C-X-C motif) receptor 5\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: NM_001716\nGene Symbol: CXCR5\nGene ID (NCBI): 643\nRRID: AB_3086040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32302\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886974488745,"sku":"28239-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28239-1-ap","provider":"Iright","version":"1.0","type":"link"}