{"product_id":"proteintech-28302-1-ap","title":"Proteintech, 28302-1-AP, H2-K1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe H2-K1 (28302-1-AP) by Proteintech is a Polyclonal antibody targeting H2-K1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n28302-1-AP targets H2-K1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat lung tissue,  RAW 264.7 cells,  mouse brain tissue,  Jurkat cells,  mouse liver tissue,  mouse lung tissue,  mouse spleen tissue,  mouse thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nH2-K1 (histocompatibility 2, K1, K region) is a gene that encodes a class I major histocompatibility complex (MHC) protein in the mouse (Mus musculus). This protein plays a crucial role in the immune system by presenting peptide antigens to T cells, which is essential for the activation of cytotoxic T lymphocytes (CTLs) and the subsequent immune response.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28456 Product name: Recombinant mouse H2-K1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 48-262 aa of NM_001001892 Sequence: YVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTF Predict reactive species\nFull Name: histocompatibility 2, K1, K region\nCalculated Molecular Weight: 41 aa\nObserved Molecular Weight: 42-50 kDa\nGenBank Accession Number: NM_001001892\nGene Symbol: H2-K1\nGene ID (NCBI): 14972\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01901\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887662452905,"sku":"28302-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28302-1-ap","provider":"Iright","version":"1.0","type":"link"}