{"product_id":"proteintech-28318-1-ap","title":"Proteintech, 28318-1-AP, PDS5B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDS5B (28318-1-AP) by Proteintech is a Polyclonal antibody targeting PDS5B in WB, ELISA applications with reactivity to human, mouse samples\n28318-1-AP targets PDS5B in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, SKOV-3 cells,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDS5B (PDS5 Cohesin Scc1-like Protein B) is a protein associated with sister chromatid cohesion and maintenance of chromosome structure. It plays a significant role in cell cycle regulation, DNA repair, and gene expression. PDS5B interacts with the cohesin complex to ensure the proper separation of sister chromatids during cell division. Additionally, PDS5B is crucial in DNA damage repair, particularly during homologous recombination, helping to maintain genomic stability. It also indirectly affects gene expression and chromatin structure by modulating the function of the cohesin complex. PDS5B is widely expressed during embryonic development and is highly expressed in the brain and testes in adulthood. Its dysfunction is associated with multiple diseases, including Cohesinopathies and Cornelia de Lange syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27977 Product name: Recombinant human PDS5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1139-1310 aa of NM_015032 Sequence: MSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKT Predict reactive species\nFull Name: PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)\nCalculated Molecular Weight: 165 aa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: NM_015032\nGene Symbol: PDS5B\nGene ID (NCBI): 23047\nRRID: AB_2881111\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NTI5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887755907241,"sku":"28318-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28318-1-ap","provider":"Iright","version":"1.0","type":"link"}