{"product_id":"proteintech-28322-1-ap","title":"Proteintech, 28322-1-AP, GIPR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GIPR (28322-1-AP) by Proteintech is a Polyclonal antibody targeting GIPR in WB, IHC, ELISA applications with reactivity to human, mouse samples\n28322-1-AP targets GIPR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, K-562 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28143 Product name: Recombinant human GIPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 401-466 aa of BC093723 Sequence: SEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC Predict reactive species\nFull Name: gastric inhibitory polypeptide receptor\nCalculated Molecular Weight: 466 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC093723\nGene Symbol: GIPR\nGene ID (NCBI): 2696\nRRID: AB_2881113\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48546\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869687369897,"sku":"28322-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28322-1-ap","provider":"Iright","version":"1.0","type":"link"}