{"product_id":"proteintech-28323-1-ap","title":"Proteintech, 28323-1-AP, ADRB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADRB1 (28323-1-AP) by Proteintech is a Polyclonal antibody targeting ADRB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28323-1-AP targets ADRB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADRB1 (adrenergic receptor beta 1), a member of the G protein-coupled receptor (GPCR) superfamily, responds to catecholamine stimulation. ADRB1 is the predominant subtype expressed in the heart and mediates increases in inotropy and chronotropy when stimulated. ADRB1 mediates a wide range of cardiovascular physiological responses and has been of great interest to researchers as a therapeutic target for cardiovascular diseases. Moreover, three subtypes of ADRBs (ADRB1, ADRB2, and ADRB3) are encoded by three separate genes (PMID:16636683; 33372534; 33593484).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28223 Product name: Recombinant human ADRB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 388-477 aa of NM_000684 Sequence: MQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV Predict reactive species\nFull Name: adrenergic, beta-1-, receptor\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: NM_000684\nGene Symbol: ADRB1\nGene ID (NCBI): 153\nRRID: AB_3086044\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08588\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868975943849,"sku":"28323-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28323-1-ap","provider":"Iright","version":"1.0","type":"link"}