{"product_id":"proteintech-28334-1-ap","title":"Proteintech, 28334-1-AP, HDAC9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDAC9 (28334-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC9 in WB, IF\/ICC, ELISA applications with reactivity to Human, Mouse samples\n28334-1-AP targets HDAC9 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, MDA-MB-231 cells,  MDA-MB-468 cells,  mouse brain tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHDAC9, also named as Histone deacetylase 7B, is a 1011 amino acid protein, which is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3, and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression, and developmental events. HDAC9 represses MEF2-dependent transcription. HDAC9 is broadly expressed, with highest levels in brain, heart, muscle, and testis. HDAC9 has 11 isoforms produced by alternative splicing. The observed molecular weight of HDAC9 is 57 kDa, which represents alternate isoforms of HDAC9.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28514 Product name: Recombinant human HDAC9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 335-440 aa of BC152405 Sequence: PAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKL Predict reactive species\nFull Name: histone deacetylase 9\nCalculated Molecular Weight: 1011 aa, 111 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC152405\nGene Symbol: HDAC9\nGene ID (NCBI): 9734\nRRID: AB_3669652\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869691891881,"sku":"28334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28334-1-ap","provider":"Iright","version":"1.0","type":"link"}