{"product_id":"proteintech-28338-1-ap","title":"Proteintech, 28338-1-AP, TOX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOX3 (28338-1-AP) by Proteintech is a Polyclonal antibody targeting TOX3 in WB, ELISA applications with reactivity to human, mouse samples\n28338-1-AP targets TOX3 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOX3, also known as TNRC9 (trinucleotide repeat containing 9), is a neuronal transcription factor containing a nuclear localization signal and a high mobility group (HMG)-box domain followed by a C-terminal poly-glutamine stretch. TOX3 is specifically expressed in the estrogen receptor alpha positive (ER+) subset of murine mammary luminal epithelial cells, including a recently identified progenitor cell subset (PMID: 19196971). TOX3 expression is negatively correlated with the immunotherapy targets PD-1, PD-L1 and HAVCR2 in lung adenocarcinoma, indicating that it serves a role in immunity activation (PMID: 27080130).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28251 Product name: Recombinant human TOX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of NM_001080430 Sequence: MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSG Predict reactive species\nFull Name: TOX high mobility group box family member 3\nCalculated Molecular Weight: 63 aa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: NM_001080430\nGene Symbol: TOX3\nGene ID (NCBI): 27324\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15405\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887835599017,"sku":"28338-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28338-1-ap","provider":"Iright","version":"1.0","type":"link"}