{"product_id":"proteintech-28345-1-ap","title":"Proteintech, 28345-1-AP, GDF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GDF1 (28345-1-AP) by Proteintech is a Polyclonal antibody targeting GDF1 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n28345-1-AP targets GDF1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse skeletal muscle tissue,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGDF1 is a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. Studies in rodents suggest that this protein is involved in the establishment of left-right asymmetry in early embryogenesis and in neural development in later embryogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28831 Product name: Recombinant human GDF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-273 aa of NM_001492 Sequence: LFRRRDPQETRSGSRRTSPGVTLQPCHVEELGVAGNIVRHIPDRGAPTRASEPASAAGHCPEWTVVFDLSAVEPAERPSRARLELRFAAAAAAAPEGGWELSVAQAGQGAGADPGPVLLRQLVPALGPPVRAELLGAAWARNASWPRSLRLALALRPRAPAACARLAEASLLLVTLDPRLCHPLARPRRDAEPVLGGGPGGACRARRLY Predict reactive species\nFull Name: growth differentiation factor 1\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: NM_001492\nGene Symbol: GDF1\nGene ID (NCBI): 2657\nRRID: AB_3086045\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P27539\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887649378473,"sku":"28345-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28345-1-ap","provider":"Iright","version":"1.0","type":"link"}