{"product_id":"proteintech-28358-1-ap","title":"Proteintech, 28358-1-AP, Caveolin-3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caveolin-3 (28358-1-AP) by Proteintech is a Polyclonal antibody targeting Caveolin-3 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n28358-1-AP targets Caveolin-3 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, mouse heart tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: mouse heart tissue, rat skeletal muscle tissue,  mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\nPositive IF\/ICC detected in: H9C2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28009 Product name: Recombinant human Caveolin-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-40 aa of BC069368 Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVD Predict reactive species\nFull Name: caveolin 3\nCalculated Molecular Weight: 151 aa, 17 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC069368\nGene Symbol: Caveolin-3\nGene ID (NCBI): 859\nRRID: AB_2881120\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56539\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869449310377,"sku":"28358-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28358-1-ap","provider":"Iright","version":"1.0","type":"link"}