{"product_id":"proteintech-28378-1-ap","title":"Proteintech, 28378-1-AP, Integrin beta-6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin beta-6 (28378-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin beta-6 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n28378-1-AP targets Integrin beta-6 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nITGB6 belongs to the integrin beta chain family. ITGB6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalisation of integrin alpha-V\/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29002 Product name: Recombinant human Integrin beta-6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 596-709 aa of BC121178 Sequence: DCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIP Predict reactive species\nFull Name: integrin, beta 6\nCalculated Molecular Weight: 788 aa, 86 kDa\nObserved Molecular Weight: 97 kDa\nGenBank Accession Number: BC121178\nGene Symbol: Integrin beta 6\nGene ID (NCBI): 3694\nRRID: AB_2918157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18564\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869412872361,"sku":"28378-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28378-1-ap","provider":"Iright","version":"1.0","type":"link"}