{"product_id":"proteintech-28380-1-ap","title":"Proteintech, 28380-1-AP, FNIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FNIP1 (28380-1-AP) by Proteintech is a Polyclonal antibody targeting FNIP1 in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n28380-1-AP targets FNIP1 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IF\/ICC detected in: C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFolliculin-interacting protein 1 (FNIP1) forms a complex with the protein folliculin (FLCN), together acting as guanosine triphosphate (GTP)-activating protein (GAP) for RagC. The FNIP1-FLCN complex has emerged as an amino acid sensor to the mechanistic target of rapamycin complex 1 (mTORC1), involved in how amino acids control TFEB activation. AMPK phosphorylation of FNIP1 induces lysosomal and mitochondrial biogenesis (PMID: 37079666)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28976 Product name: Recombinant human FNIP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 163-250 aa of BC001956 Sequence: FTARTGSSICGSLNTLQDSLEFINQDNNTLKADNNTVINGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNPMDMPGRELNE Predict reactive species\nFull Name: folliculin interacting protein 1\nCalculated Molecular Weight: 508 aa, 57 kDa\nObserved Molecular Weight: 130-150 kDa\nGenBank Accession Number: BC001956\nGene Symbol: FNIP1\nGene ID (NCBI): 96459\nRRID: AB_2881128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TF40\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869684584617,"sku":"28380-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28380-1-ap","provider":"Iright","version":"1.0","type":"link"}