{"product_id":"proteintech-28392-1-ap","title":"Proteintech, 28392-1-AP, TRIM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM3 (28392-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28392-1-AP targets TRIM3 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM3, a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM family of genes is largely studied because of their roles in development, differentiation and host cell antiviral defenses. TRIM3 is a mammalian tumor suppressor whose loss can increase the incidence and promote the development of GBM(PMID: 23318451). TRIM3 has four isoforms with the MW of 67-80 kDa and can be detected as 75, 80, 82,85 kDa after posttranslational modification(PMID: 24947043\/PMID: 24086586 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28823 Product name: Recombinant human TRIM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-324 aa of NM_001248006 Sequence: SQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHE Predict reactive species\nFull Name: tripartite motif-containing 3\nCalculated Molecular Weight: 81 kDa\nObserved Molecular Weight: 75 kDa, 80-85 kDa\nGenBank Accession Number: NM_001248006\nGene Symbol: TRIM3\nGene ID (NCBI): 10612\nRRID: AB_2881131\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75382\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869437972649,"sku":"28392-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28392-1-ap","provider":"Iright","version":"1.0","type":"link"}