{"product_id":"proteintech-28393-1-ap","title":"Proteintech, 28393-1-AP, Beta TRCP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Beta TRCP (28393-1-AP) by Proteintech is a Polyclonal antibody targeting Beta TRCP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28393-1-AP targets Beta TRCP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, NIH\/3T3 cells,  U-251 cells,  Ramos cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBTRC, also named as BTRCP, FBW1A, and FBXW1A, is an F-box family protein. It is a Substrate recognition component of an SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. BTRC targets many important proteins with diverse functions, such as p53, HRAS, NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5, and the cell cycle checkpoint protein claspin, for ubiquitin-mediated degradation. It is required for the activation of NFKB-mediated transcription by IL1B, MAP3K14, MAP3K1, IKBKB, and TNF. Required for proteolytic processing of GLI3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28739 Product name: Recombinant human BETA-TRCP,BTRC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 308-605 aa of BC027994 Sequence: CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR Predict reactive species\nFull Name: beta-transducin repeat containing\nCalculated Molecular Weight: 605 aa, 69 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC027994\nGene Symbol: Beta TRCP\nGene ID (NCBI): 8945\nRRID: AB_2935467\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y297\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869518188713,"sku":"28393-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28393-1-ap","provider":"Iright","version":"1.0","type":"link"}