{"product_id":"proteintech-28403-1-ap","title":"Proteintech, 28403-1-AP, TAOK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAOK3 (28403-1-AP) by Proteintech is a Polyclonal antibody targeting TAOK3 in WB, ELISA applications with reactivity to Human samples\n28403-1-AP targets TAOK3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAOK3 (Serine\/threonine-protein kinase TAO3) is also named as DPK, JIK, KDS, MAP3K18. It belongs to the STE Ser\/Thr protein kinase family. TAOK3 acts as an activator of the p38\/MAPK14 stress-activated MAPK cascade. In response to DNA damage, it is involved in the G2\/M transition DNA damage checkpoint by activating the p38\/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. The protein can also be autophosphorylated (PMID:20949042).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29158 Product name: Recombinant human TAOK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-430 aa of BC002756 Sequence: SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR Predict reactive species\nFull Name: TAO kinase 3\nCalculated Molecular Weight: 105 kDa\nObserved Molecular Weight: 100-105 kDa\nGenBank Accession Number: BC002756\nGene Symbol: TAOK3\nGene ID (NCBI): 51347\nRRID: AB_2918158\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H2K8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887822786729,"sku":"28403-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28403-1-ap","provider":"Iright","version":"1.0","type":"link"}