{"product_id":"proteintech-28423-1-ap","title":"Proteintech, 28423-1-AP, PMCA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PMCA2 (28423-1-AP) by Proteintech is a Polyclonal antibody targeting PMCA2 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat samples\n28423-1-AP targets PMCA2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled mouse brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP2B2, also named as PMCA2, belongs to the cation transport ATPase (P-type) family and type IIB subfamily. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28994 Product name: Recombinant human PMCA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 578-782 aa of NM_001001331 Sequence: LDLKQDYEPVRSQMPEEKLYKVYTFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGAGEPRVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEKGEIEQERIDKIW Predict reactive species\nFull Name: ATPase, Ca++ transporting, plasma membrane 2\nCalculated Molecular Weight: 137 kDa\nObserved Molecular Weight: 137 kDa\nGenBank Accession Number: NM_001001331\nGene Symbol: PMCA2\nGene ID (NCBI): 491\nRRID: AB_3086051\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01814\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869731737769,"sku":"28423-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28423-1-ap","provider":"Iright","version":"1.0","type":"link"}