{"product_id":"proteintech-28432-1-ap","title":"Proteintech, 28432-1-AP, OLFM4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OLFM4 (28432-1-AP) by Proteintech is a Polyclonal antibody targeting OLFM4 in IHC, ELISA applications with reactivity to Human samples\n28432-1-AP targets OLFM4 in IHC, IF, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOlfactomedin-4 (OLFM4), also named as hGC-1 (human G-CSF-stimulated clone-1) or antiapoptotic protein GW112, is a secreted glycoprotein normally expressed in bone marrow, prostate, small intestine, stomach, colon and pancreas (PMID: 11867215; PMID: 22471589). OLFM4 has been found to be up-regulated in gastrointestinal cancer and inflammatory disease including inflammatory bowel disease and H. pylori infection (PMID: 20534456). OLFM4 is involved in cellular process such as apoptosis, cell adhesion and tumor growth (PMID: 22471589; 16566923; 15059901).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28914 Product name: Recombinant human OLFM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-233 aa of NM_006418 Sequence: LGSGGSVSQLFSNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQN Predict reactive species\nFull Name: olfactomedin 4\nCalculated Molecular Weight: 57 kDa\nGenBank Accession Number: NM_006418\nGene Symbol: OLFM4\nGene ID (NCBI): 10562\nRRID: AB_2918163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UX06\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869478080681,"sku":"28432-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28432-1-ap","provider":"Iright","version":"1.0","type":"link"}