{"product_id":"proteintech-28436-1-ap","title":"Proteintech, 28436-1-AP, IRG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRG1 (28436-1-AP) by Proteintech is a Polyclonal antibody targeting IRG1 in WB, ELISA applications with reactivity to human, mouse samples\n28436-1-AP targets IRG1 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IFN gamma+LPS treated THP-1 cells, LPS treated RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe host Immune-Responsive Gene 1 (IRG1; also called Acod1) is a mitochondrial enzyme induced under inflammatory conditions that produces the metabolite itaconate by decarboxylating cis-aconitate, a TCA cycle intermediate. Gene expression profiling studies of murine macrophages and microglial cells have revealed that IRG1 is highly expressed under pro-inflammatory conditions. Furthermore, IRG1 is highly expressed in the pregnant uterus during the early events leading to implantation, the specific phase of pregnancy in which high levels of inflammatory cytokines are secreted. IRG1 localizes to the mitochondria and may represent a key link between immunological and metabolic processes. IRG1 has crucial functions in embryonic implantation and neurodegeneration. Also, IRG1 promotes endotoxin tolerance by increasing A20 expression in macrophages via increased ROS production. (PMID: 25640654)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28913 Product name: Recombinant human IRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-481 aa of NM_001258406 Sequence: DAAASVRKHLVAERALLPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVPSFHECQINRPQVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEEKFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNLS Predict reactive species\nFull Name: immunoresponsive 1 homolog (mouse)\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: NM_001258406\nGene Symbol: IRG1\nGene ID (NCBI): 730249\nRRID: AB_2935468\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6NK06\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868956905641,"sku":"28436-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28436-1-ap","provider":"Iright","version":"1.0","type":"link"}