{"product_id":"proteintech-28437-1-ap","title":"Proteintech, 28437-1-AP, KMT2C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KMT2C (28437-1-AP) by Proteintech is a Polyclonal antibody targeting KMT2C in WB, IHC, ELISA applications with reactivity to human samples\n28437-1-AP targets KMT2C in WB, IHC, IF, CoIP, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLysine (K)-specific methyltransferase 2C (KMT2C, also known as MLL3) belongs to the mixed-lineage leukemia (MLL) family of histone methyltransferases which methylate the histone 3 tail at lysine 4 (H3K4) as part of the complex proteins associated with Set 1 (COMPASS) complex. Although originally identified as oncogenic fusions in leukemia, genome-wide mutation studies have revealed frequent, presumably loss-of-function, mutations in various members of the MLL family, including MLL2\/KMT2B, MLL3\/KMT2C, and MLL4\/KMT2D in a variety of malignancies, particularly solid tumors. Mechanistic studies of KMT2C in normal cells have focused primarily on its role in enhancer regulation by deposition of H3K4me1 marks.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28875 Product name: Recombinant human KMT2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2771-3000 aa of NM_170606 Sequence: SMFNEELDLPIDDKLDNQCVSVEPKKKEQENKTLVLSDKHSPQKKSTVTNEVKTEVLSPNSKVESKCETEKNDENKDNVDTPCSQASAHSDLNDGEKTSLHPCDPDLFEKRTNRETAGPSANVIQASTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDIRPSGSPPPPTLPASPSNHVSSLPPFIAPPGRVLDNAMNSNVTVVSRVNHVFSQGVQVNPGLIPGQSTV Predict reactive species\nFull Name: myeloid\/lymphoid or mixed-lineage leukemia 3\nCalculated Molecular Weight: 541 kDa\nObserved Molecular Weight: 541kDa, 269 kDa\nGenBank Accession Number: NM_170606\nGene Symbol: KMT2C\nGene ID (NCBI): 58508\nRRID: AB_2918165\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NEZ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869001601193,"sku":"28437-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28437-1-ap","provider":"Iright","version":"1.0","type":"link"}