{"product_id":"proteintech-28513-1-ap","title":"Proteintech, 28513-1-AP, TYRO3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TYRO3 (28513-1-AP) by Proteintech is a Polyclonal antibody targeting TYRO3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n28513-1-AP targets TYRO3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HCT 116 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTYRO3 has a structure includes a cytoplasmic domain and an extracellular ligand binding region. And ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. TYRO3 is associated with many physiological processes including cell survival, migration and differentiation. It has been reported that TYRO3 can be expressed in various regions of the mammalian central nervous system. 28513-1-AP antibody recognizes the 97 kDa and 140 kDa protein which might be the glycosylated form similar to the papers.((PMID: 8873131, 23354874, 21539887)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29540 Product name: Recombinant human TYRO3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 451-596 aa of BC049368 Sequence: LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL Predict reactive species\nFull Name: TYRO3 protein tyrosine kinase\nCalculated Molecular Weight: 97 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC049368\nGene Symbol: TYRO3\nGene ID (NCBI): 7301\nRRID: AB_2881162\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q06418\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869624717481,"sku":"28513-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28513-1-ap","provider":"Iright","version":"1.0","type":"link"}