{"product_id":"proteintech-28530-1-ap","title":"Proteintech, 28530-1-AP, IGF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IGF1 (28530-1-AP) by Proteintech is a Polyclonal antibody targeting IGF1 in IHC, ELISA applications with reactivity to Human, mouse samples\n28530-1-AP targets IGF1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver tissue, mouse kidney tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIGF1, also named as IBP1, MGF, IGF-IA, and Somatomedin-C, belongs to the INS family. IGF1 is structurally and functionally related to INS but has a much higher growth-promoting activity. Altered expression or mutation of IGF-1 is associated with several human disorders, including type I diabetes and various forms of cancer. Defects in IGF1 are the cause of INS-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness, and mental retardation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29197 Product name: Recombinant human IGF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 49-118 aa of NM_001111285.2 Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKS Predict reactive species\nFull Name: insulin-like growth factor 1 (somatomedin C)\nCalculated Molecular Weight: 22 kDa\nGenBank Accession Number: NM_001111285.2\nGene Symbol: IGF1\nGene ID (NCBI): 3479\nRRID: AB_2881164\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05019\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868857880745,"sku":"28530-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28530-1-ap","provider":"Iright","version":"1.0","type":"link"}