{"product_id":"proteintech-28534-1-ap","title":"Proteintech, 28534-1-AP, DNA-PKcs Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNA-PKcs (28534-1-AP) by Proteintech is a Polyclonal antibody targeting DNA-PKcs in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n28534-1-AP targets DNA-PKcs in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells\nPositive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRKDC, also named as HYRC, HYRC1, DNPK1 and p460, belongs to the PI3\/PI4-kinase family. PRKDC is a serine\/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ), PRKDC is required for double-strand break (DSB) repair and V(D)J recombination. PRKDC must be bound to DNA to express its catalytic properties. It promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). It is required to protect and align broken ends of DNA. PRKDC may also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. It is found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. It also involved in modulation of transcription. It recognizes the substrate consensus sequence [ST]-Q. PRKDC phosphorylates 'Ser-139' of histone variant H2AX\/H2AFX, thereby regulating DNA damage response mechanism. It phosphorylates DCLRE1C, c-Abl\/ABL1, histone H1, HSPCA, c-jun\/JUN, p53\/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, c-myc\/MYC and RFA2. The antibody recognizes the C-term of PRKDC.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29100 Product name: Recombinant human PRKDC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3979-4128 aa of NM_006904 Sequence: LMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM Predict reactive species\nFull Name: protein kinase, DNA-activated, catalytic polypeptide\nCalculated Molecular Weight: 469 kDa\nObserved Molecular Weight: 350-460 kDa\nGenBank Accession Number: NM_006904\nGene Symbol: PRKDC\nGene ID (NCBI): 5591\nRRID: AB_2881165\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78527\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869531951273,"sku":"28534-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28534-1-ap","provider":"Iright","version":"1.0","type":"link"}