{"product_id":"proteintech-28535-1-ap","title":"Proteintech, 28535-1-AP, GABRA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GABRA2 (28535-1-AP) by Proteintech is a Polyclonal antibody targeting GABRA2 in WB, ELISA applications with reactivity to human, rat samples\n28535-1-AP targets GABRA2 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2), also known as DEE78. It is expected to be located in cell membrane, and the protein is highly expressed in brain. The protein is a ligand-gated chloride channel, which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:29961870). It also plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (PubMed:29961870). The calculated molecular weight of GABRA2 is 51 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29301 Product name: Recombinant human GABRA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 348-412 aa of NM_000807 Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN Predict reactive species\nFull Name: gamma-aminobutyric acid (GABA) A receptor, alpha 2\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: NM_000807\nGene Symbol: GABRA2\nGene ID (NCBI): 2555\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47869\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887645544617,"sku":"28535-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28535-1-ap","provider":"Iright","version":"1.0","type":"link"}