{"product_id":"proteintech-28544-1-ap","title":"Proteintech, 28544-1-AP, DLL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLL1 (28544-1-AP) by Proteintech is a Polyclonal antibody targeting DLL1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n28544-1-AP targets DLL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, MG-63 cells,  HeLa cells,  HUVEC cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Notch pathway functions during diverse developmental and physiological processes. Notch receptor and its ligands, Delta and Jagged, are transmembrane proteins with large extracellular domains that consist primarily of epidermal growth factor (EGF)-like repeats (PMID: 16921404). Delta-like protein 1 (DLL1, also named as Delta1) is a ligand of NOTCH1, NOTCH2 and NOTCH3 receptors that binds the extracellular domain of Notch receptor in a cis and trans fashion manner (PMID: 11006133). DLL1 play a role in development of the central nervous system, somites and lymphocytes (PMID: 31353024). It is overexpressed in various cancers and is involved in the regulation of cancer progression (PMID: 32440154). DLL1 undergoes proteolytic processing in its extracellular domain by ADAM proteases and gamma-secretase (PMID: 17107962; 12794186).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29534 Product name: Recombinant human DLL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 568-715 aa of NM_005618 Sequence: CVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKD Predict reactive species\nFull Name: delta-like 1 (Drosophila)\nCalculated Molecular Weight: 78 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_005618\nGene Symbol: DLL1\nGene ID (NCBI): 28514\nRRID: AB_3086063\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00548\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869403304105,"sku":"28544-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28544-1-ap","provider":"Iright","version":"1.0","type":"link"}